PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011096935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 357aa    MW: 41027.1 Da    PI: 6.7961
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011096935.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.7e-082763141854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  XP_011096935.1 276 MFQNflHPYPKDAEKHLLALKSGLTRNQVSNWFINARVR 314
                     5887779******************************88 PP

2BELL70.13.8e-23150218372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +  ++kk +Ll ll+ Vd+rY+++ ++++tv s+F+av++l++ ++++++Al  iS+ +++L+++i++++
  XP_011096935.1 150 RTSESKKKHLLALLQVVDERYNRCLDEIHTVTSAFHAVTELDP-NLHARFALPMISFMYKNLRERISSHV 218
                     56789**************************************.**********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-1484216IPR006563POX domain
PfamPF075261.3E-2290215IPR006563POX domain
PROSITE profilePS5007110.981255318IPR001356Homeobox domain
CDDcd000862.88E-10258319No hitNo description
SMARTSM003893.7E-5258322IPR001356Homeobox domain
SuperFamilySSF466891.59E-15259327IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-26261324IPR009057Homeodomain-like
PfamPF059201.4E-14275314IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MSYGYEGVPY DTSTRWDFSK FINPPEPVGR VTGSCPLSEW MMTEQEALNS NSRGSSRFSN  60
ELSLSLATSE PSVVHGSCIL EQCSEMSSSG SRFVHAMQEI LAEIAGYALE NIEQMSYSAD  120
QIGDGVNVSF SSSLDGENTF MYRNNVLQER TSESKKKHLL ALLQVVDERY NRCLDEIHTV  180
TSAFHAVTEL DPNLHARFAL PMISFMYKNL RERISSHVLA VGAHMSKGEA TEETALETCF  240
IHKQWALQQL YKRDHQFWRP QRGLPERSVS VLRAWMFQNF LHPYPKDAEK HLLALKSGLT  300
RNQVSNWFIN ARVRLWKPMI EEMYAEMNRR KGHRNDEETG GDHRNHKGFE SRRFTTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A7e-15264322563Homeobox protein Meis2
3k2a_B7e-15264322563Homeobox protein Meis2
4xrm_A6e-15264322563Homeobox protein Meis2
4xrm_B6e-15264322563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096935.10.0PREDICTED: homeobox protein ATH1 isoform X2
SwissprotP487313e-98ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A068UKX61e-133A0A068UKX6_COFCA; Uncharacterized protein
STRINGVIT_04s0008g00880.t011e-129(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.14e-98homeobox gene 1